Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (91 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188340] (73 PDB entries) |
Domain d2ocga_: 2ocg A: [194959] automated match to d2ocla_ complexed with gol, mg, mn |
PDB Entry: 2ocg (more details), 1.75 Å
SCOPe Domain Sequences for d2ocga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ocga_ c.69.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} svtsakvavngvqlhyqqtgegdhavlllpgmlgsgetdfgpqlknlnkklftvvawdpr gyghsrppdrdfpadfferdakdavdlmkalkfkkvsllgwsdggitaliaaakypsyih kmviwganayvtdedsmiyegirdvskwsertrkplealygydyfartcekwvdgirqfk hlpdgnicrhllprvqcpalivhgekdplvprfhadfihkhvkgsrlhlmpegkhnlhlr fadefnklaedflq
Timeline for d2ocga_: