SCOPe 2.05: Domain d3zs3a_: 3zs3 A:

Lineage for d3zs3a_ (3zs3 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families)
   has two smaller insertion domains

5. Family b.25.1.0: automated matches [191382] (1 protein)
   not a true family

6. Protein automated matches [190478] (2 species)
   not a true protein

7. Species Malus x [TaxId:3750] [194955] (1 PDB entry)

8. Domain d3zs3a_: 3zs3 A: [194956]
   automated match to d2ahna_
   complexed with act, acy, fmt, sin

Details for d3zs3a_

PDB Entry: 3zs3, 1.8 Å

PDB Description: high resolution structure of mal d 2, the thaumatin like food allergen from apple

PDB Compounds: (A:) Thaumatin-like protein

SCOPe Domain Sequences for d3zs3a_:

Sequence; same for both SEQRES and ATOM records:

>d3zs3a_ b.25.1.0 (A:) automated matches {Malus x [TaxId: 3750]}
akitftnncpntvwpgtltgdqkpqlsltgfelaskasrsvdapspwsgrfwgrtrcstd
aagkftcetadcgsgqvacngagavppatlveitiaanggqdyydvslvdgfnlpmsvap
qggtgeckpsscpanvnkvcpaplqvkaadgsviscksaclafgdskycctppnntpetc
ppteyseifekqcpqaysyayddknstftcsggpdyvitfcp

Timeline for d3zs3a_:

• d3zs3a_ first appeared in SCOPe 2.02
  
• d3zs3a_ appears in SCOPe 2.04
  
• d3zs3a_ appears in SCOPe 2.06
  
• d3zs3a_ appears in the current release, SCOPe 2.08