SCOPe 2.08: Domain d4dohc1: 4doh C:25-176

Lineage for d4dohc1 (4doh C:25-176)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.0: automated matches [194949] (1 protein)
   not a true family

6. Protein automated matches [194950] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [194951] (1 PDB entry)

8. Domain d4dohc1: 4doh C:25-176 [194952]
   Other proteins in same PDB: d4doha2, d4dohc2
   automated match to d1n1fa_
   complexed with nag

Details for d4dohc1

PDB Entry: 4doh, 2.8 Å

PDB Description: il20/il201/il20r2 ternary complex

PDB Compounds: (C:) Interleukin-20

SCOPe Domain Sequences for d4dohc1:

Sequence; same for both SEQRES and ATOM records:

>d4dohc1 a.26.1.0 (C:25-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktlnlgscviatnlqeirngfseirgsvqakdgnidirilrrteslqdtkpanrccllr
hllrlyldrvfknyqtpdhytlrkisslansfltikkdlrlchahmtchcgeeamkkysq
ilshfeklepqaavvkalgeldillqwmeete

Timeline for d4dohc1:

• d4dohc1 first appeared in SCOPe 2.02, called d4dohc_
  
• d4dohc1 appears in SCOPe 2.07