Lineage for d1csma_ (1csm A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6655Fold a.130: Chorismate mutase II [48599] (1 superfamily)
  4. 6656Superfamily a.130.1: Chorismate mutase II [48600] (2 families) (S)
  5. 6662Family a.130.1.2: Allosteric chorismate mutase [48604] (1 protein)
  6. 6663Protein Allosteric chorismate mutase [48605] (1 species)
  7. 6664Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48606] (5 PDB entries)
  8. 6666Domain d1csma_: 1csm A: [19495]

Details for d1csma_

PDB Entry: 1csm (more details), 2.2 Å

PDB Description: the crystal structure of allosteric chorismate mutase at 2.2 angstroms resolution

SCOP Domain Sequences for d1csma_:

Sequence, based on SEQRES records: (download)

>d1csma_ a.130.1.2 (A:) Allosteric chorismate mutase {Baker's yeast (Saccharomyces cerevisiae)}
mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
kskdvegimknitnsaveekilerltkkaevygvdptnesgerriipeylvkiykeivip
itkeveveyllrrlee

Sequence, based on observed residues (ATOM records): (download)

>d1csma_ a.130.1.2 (A:) Allosteric chorismate mutase {Baker's yeast (Saccharomyces cerevisiae)}
mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
kskdvegimknitnsaveekilerltkkaevygvdpterriipeylvkiykeivipitke
veveyllrrlee

SCOP Domain Coordinates for d1csma_:

Click to download the PDB-style file with coordinates for d1csma_.
(The format of our PDB-style files is described here.)

Timeline for d1csma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1csmb_