Lineage for d4e1oc_ (4e1o C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1176924Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1176925Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1178026Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1178027Protein automated matches [190151] (34 species)
    not a true protein
  7. 1178085Species Human (Homo sapiens) [TaxId:9606] [188446] (10 PDB entries)
  8. 1178086Domain d4e1oc_: 4e1o C: [194948]
    automated match to d3rcha_
    complexed with plp, pvh

Details for d4e1oc_

PDB Entry: 4e1o (more details), 1.8 Å

PDB Description: Human histidine decarboxylase complex with Histidine methyl ester (HME)
PDB Compounds: (C:) histidine decarboxylase

SCOPe Domain Sequences for d4e1oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e1oc_ c.67.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gplgsmepeeyrergremvdyicqylstvrerrvtpdvqpgylraqlpesapedpdswds
ifgdieriimpgvvhwqsphmhayypaltswpsllgdmladainclgftwasspactele
mnvmdwlakmlglpehflhhhpssqgggvlqstvsestliallaarknkilemktsepda
desslnarlvayasdqahssvekaglislvkmkflpvddnfslrgealqkaieedkqrgl
vpvfvcatlgttgvcafdclselgpicareglwlhidaayagtaflcpefrgflkgieya
dsftfnpskwmmvhfdctgfwvkdkyklqqtfsvnpiylrhansgvatdfmhwqiplsrr
frsvklwfvirsfgvknlqahvrhgtemakyfeslvrndpsfeipakrhlglvvfrlkgp
nsltenvlkeiakagrlflipatiqdkliirftvtsqfttrddilrdwnlirdaatlils
q

SCOPe Domain Coordinates for d4e1oc_:

Click to download the PDB-style file with coordinates for d4e1oc_.
(The format of our PDB-style files is described here.)

Timeline for d4e1oc_:

  • d4e1oc_ appears in periodic updates to SCOPe 2.02 starting on 2013-05-28
  • d4e1oc_ appears in SCOPe 2.03
  • d4e1oc_ appears in the current release, SCOPe 2.07, called d4e1oc1