Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.0: automated matches [191466] (1 protein) not a true family |
Protein automated matches [190728] (15 species) not a true protein |
Species Azotobacter vinelandii [TaxId:354] [194940] (2 PDB entries) |
Domain d4f6ta_: 4f6t A: [194941] automated match to d2j4la_ complexed with 6m0, 8m0, atp, mg, mo, po4 |
PDB Entry: 4f6t (more details), 1.6 Å
SCOPe Domain Sequences for d4f6ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f6ta_ c.73.1.0 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]} rpirllpwlqvvkiggrvmdrgadailplveelrkllpehrlliltgagvrarhvfsvgl dlglpvgslaplaaseagqnghilaamlasegvsyvehptvadqlaihlsatravvgsaf ppyhhhefpgsripphradtgaflladafgaagltivenvdgiytadpngpdrgqarflp etsatdlaksegplpvdralldvmatarhiervqvvnglvpgrltaalrgehvgtlirtg vrpa
Timeline for d4f6ta_: