SCOPe 2.08: Domain d4f6ta_: 4f6t A:

Lineage for d4f6ta_ (4f6t A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (15 species)
   not a true protein

7. Species Azotobacter vinelandii [TaxId:354] [194940] (7 PDB entries)

8. Domain d4f6ta_: 4f6t A: [194941]
   automated match to d2j4la_
   complexed with 6m0, 8m0, atp, mg, mo, po4

Details for d4f6ta_

PDB Entry: 4f6t, 1.6 Å

PDB Description: The crystal structure of the molybdenum storage protein (MoSto) from Azotobacter vinelandii loaded with various polyoxometalates

PDB Compounds: (A:) Molybdenum storage protein subunit alpha

SCOPe Domain Sequences for d4f6ta_:

Sequence; same for both SEQRES and ATOM records:

>d4f6ta_ c.73.1.0 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]}
rpirllpwlqvvkiggrvmdrgadailplveelrkllpehrlliltgagvrarhvfsvgl
dlglpvgslaplaaseagqnghilaamlasegvsyvehptvadqlaihlsatravvgsaf
ppyhhhefpgsripphradtgaflladafgaagltivenvdgiytadpngpdrgqarflp
etsatdlaksegplpvdralldvmatarhiervqvvnglvpgrltaalrgehvgtlirtg
vrpa

Timeline for d4f6ta_:

• d4f6ta_ first appeared in SCOPe 2.02
  
• d4f6ta_ appears in SCOPe 2.07