Lineage for d4f6rd_ (4f6r D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1229098Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1229099Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1229100Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 1229189Protein automated matches [190101] (6 species)
    not a true protein
  7. 1229190Species Artificial gene [TaxId:32630] [193962] (2 PDB entries)
  8. 1229192Domain d4f6rd_: 4f6r D: [194939]
    automated match to d3q9nd_
    complexed with gdp, gtp, mes, mg, so4

Details for d4f6rd_

PDB Entry: 4f6r (more details), 2.64 Å

PDB Description: Tubulin:Stathmin-like domain complex
PDB Compounds: (D:) Designed ankyrin repeat protein (DARPIN) D2

SCOPe Domain Sequences for d4f6rd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f6rd_ d.211.1.1 (D:) automated matches {Artificial gene [TaxId: 32630]}
gsdlgkklleaaragqddevrilmangadvnaeddsgktplhlaaikghleivevllkhg
advnaadkmgdtplhlaalyghleivevllkngadvnatdtygftplhlaadaghleive
vllkygadvnaqdkfgktafdisidngnedlaeilqkln

SCOPe Domain Coordinates for d4f6rd_:

Click to download the PDB-style file with coordinates for d4f6rd_.
(The format of our PDB-style files is described here.)

Timeline for d4f6rd_: