| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) ![]() repeats organized in elongated structures |
| Family d.211.1.1: Ankyrin repeat [48404] (18 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
| Protein automated matches [190101] (6 species) not a true protein |
| Species Artificial gene [TaxId:32630] [193962] (2 PDB entries) |
| Domain d4f6rd_: 4f6r D: [194939] automated match to d3q9nd_ complexed with gdp, gtp, mes, mg, so4 |
PDB Entry: 4f6r (more details), 2.64 Å
SCOPe Domain Sequences for d4f6rd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f6rd_ d.211.1.1 (D:) automated matches {Artificial gene [TaxId: 32630]}
gsdlgkklleaaragqddevrilmangadvnaeddsgktplhlaaikghleivevllkhg
advnaadkmgdtplhlaalyghleivevllkngadvnatdtygftplhlaadaghleive
vllkygadvnaqdkfgktafdisidngnedlaeilqkln
Timeline for d4f6rd_: