SCOPe 2.08: Domain d4f6rd1: 4f6r D:13-169

Lineage for d4f6rd1 (4f6r D:13-169)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (7 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [193962] (5 PDB entries)

8. Domain d4f6rd1: 4f6r D:13-169 [194939]
   Other proteins in same PDB: d4f6ra1, d4f6ra2, d4f6rb1, d4f6rb2, d4f6rd2
   automated match to d3q9nd_
   complexed with gdp, gtp, mes, mg, so4

Details for d4f6rd1

PDB Entry: 4f6r, 2.64 Å

PDB Description: Tubulin:Stathmin-like domain complex

PDB Compounds: (D:) Designed ankyrin repeat protein (DARPIN) D2

SCOPe Domain Sequences for d4f6rd1:

Sequence; same for both SEQRES and ATOM records:

>d4f6rd1 d.211.1.1 (D:13-169) automated matches {Artificial gene [TaxId: 32630]}
dlgkklleaaragqddevrilmangadvnaeddsgktplhlaaikghleivevllkhgad
vnaadkmgdtplhlaalyghleivevllkngadvnatdtygftplhlaadaghleivevl
lkygadvnaqdkfgktafdisidngnedlaeilqkln

Timeline for d4f6rd1:

• d4f6rd1 first appeared in SCOPe 2.02, called d4f6rd_
  
• d4f6rd1 appears in SCOPe 2.07