Lineage for d4f6rd1 (4f6r D:13-169)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563231Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2563232Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2563233Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
  6. 2563325Protein automated matches [190101] (7 species)
    not a true protein
  7. 2563326Species Artificial gene [TaxId:32630] [193962] (5 PDB entries)
  8. 2563332Domain d4f6rd1: 4f6r D:13-169 [194939]
    Other proteins in same PDB: d4f6ra1, d4f6ra2, d4f6rb1, d4f6rb2, d4f6rd2
    automated match to d3q9nd_
    complexed with gdp, gtp, mes, mg, so4

Details for d4f6rd1

PDB Entry: 4f6r (more details), 2.64 Å

PDB Description: Tubulin:Stathmin-like domain complex
PDB Compounds: (D:) Designed ankyrin repeat protein (DARPIN) D2

SCOPe Domain Sequences for d4f6rd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f6rd1 d.211.1.1 (D:13-169) automated matches {Artificial gene [TaxId: 32630]}
dlgkklleaaragqddevrilmangadvnaeddsgktplhlaaikghleivevllkhgad
vnaadkmgdtplhlaalyghleivevllkngadvnatdtygftplhlaadaghleivevl
lkygadvnaqdkfgktafdisidngnedlaeilqkln

SCOPe Domain Coordinates for d4f6rd1:

Click to download the PDB-style file with coordinates for d4f6rd1.
(The format of our PDB-style files is described here.)

Timeline for d4f6rd1: