Lineage for d3bd9a1 (3bd9 A:88-346)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114207Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)
  8. 2114296Domain d3bd9a1: 3bd9 A:88-346 [194933]
    Other proteins in same PDB: d3bd9a2
    automated match to d1zrha_
    complexed with a3p

Details for d3bd9a1

PDB Entry: 3bd9 (more details), 2.3 Å

PDB Description: human 3-O-sulfotransferase isoform 5 with bound PAP
PDB Compounds: (A:) Heparan sulfate glucosamine 3-O-sulfotransferase 5

SCOPe Domain Sequences for d3bd9a1:

Sequence, based on SEQRES records: (download)

>d3bd9a1 c.37.1.0 (A:88-346) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qqlpkaiiigvrkggtrallemlnlhpavvkasqeihffdndenygkgiewyrkkmpfsy
pqqitiekspayfiteevperiykmnssiklliivrepttraisdytqvlegkerknkty
ykfeklaidpntcevntkykavrtsiytkhlerwlkyfpieqfhvvdgdrliteplpelq
lvekflnlpprisqynlyfnatrgfyclrfneifnkclagskgrihpevdpsvitklrkf
fhpfnqkfyqitgrtlnwp

Sequence, based on observed residues (ATOM records): (download)

>d3bd9a1 c.37.1.0 (A:88-346) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qqlpkaiiigvrkggtrallemlnlhpavvkasqeihffdndenygkgiewyrkkmpfsy
pqqitiekspayfiteevperiykmnssiklliivrepttraisdytqvlegkerknkty
ykfeklaidpntcevntkykavrtsiytkhlerwlkyfpieqfhvvdgdrliteplpelq
lvekflnlpprisqynlyfnatrgfyclrfneifnkclarihpevdpsvitklrkffhpf
nqkfyqitgrtlnwp

SCOPe Domain Coordinates for d3bd9a1:

Click to download the PDB-style file with coordinates for d3bd9a1.
(The format of our PDB-style files is described here.)

Timeline for d3bd9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bd9a2