![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
![]() | Superfamily a.130.1: Chorismate mutase II [48600] (4 families) ![]() |
![]() | Family a.130.1.1: Dimeric chorismate mutase [48601] (3 proteins) intertwined homodimer of 3-helical subunits |
![]() | Protein Chorismate mutase domain of P-protein [48602] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [48603] (1 PDB entry) |
![]() | Domain d1ecmb_: 1ecm B: [19493] CASP1 complexed with tsa; mutant |
PDB Entry: 1ecm (more details), 2.2 Å
SCOP Domain Sequences for d1ecmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ecmb_ a.130.1.1 (B:) Chorismate mutase domain of P-protein {Escherichia coli [TaxId: 562]} pllalrekisaldekllallaerrelavevgkakllshrpvrdidrerdllerlitlgka hhldahyitrlfqliiedsvltqqallqqhlnkin
Timeline for d1ecmb_: