Lineage for d1ecmb_ (1ecm B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732498Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2732499Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2732500Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
    intertwined homodimer of 3-helical subunits
  6. 2732501Protein Chorismate mutase domain of P-protein [48602] (2 species)
  7. 2732502Species Escherichia coli [TaxId:562] [48603] (1 PDB entry)
  8. 2732504Domain d1ecmb_: 1ecm B: [19493]
    CASP1
    complexed with tsa

Details for d1ecmb_

PDB Entry: 1ecm (more details), 2.2 Å

PDB Description: atomic structure of the buried catalytic pocket of escherichia coli chorismate mutase
PDB Compounds: (B:) endo-oxabicyclic transition state analogue

SCOPe Domain Sequences for d1ecmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecmb_ a.130.1.1 (B:) Chorismate mutase domain of P-protein {Escherichia coli [TaxId: 562]}
pllalrekisaldekllallaerrelavevgkakllshrpvrdidrerdllerlitlgka
hhldahyitrlfqliiedsvltqqallqqhlnkin

SCOPe Domain Coordinates for d1ecmb_:

Click to download the PDB-style file with coordinates for d1ecmb_.
(The format of our PDB-style files is described here.)

Timeline for d1ecmb_: