SCOPe 2.08: Domain d1ecmb_: 1ecm B:

Lineage for d1ecmb_ (1ecm B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (5 families)

5. Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
   intertwined homodimer of 3-helical subunits

6. Protein Chorismate mutase domain of P-protein [48602] (2 species)

7. Species Escherichia coli [TaxId:562] [48603] (1 PDB entry)

8. Domain d1ecmb_: 1ecm B: [19493]
   CASP1
   complexed with tsa

Details for d1ecmb_

PDB Entry: 1ecm, 2.2 Å

PDB Description: atomic structure of the buried catalytic pocket of escherichia coli chorismate mutase

PDB Compounds: (B:) endo-oxabicyclic transition state analogue

SCOPe Domain Sequences for d1ecmb_:

Sequence; same for both SEQRES and ATOM records:

>d1ecmb_ a.130.1.1 (B:) Chorismate mutase domain of P-protein {Escherichia coli [TaxId: 562]}
pllalrekisaldekllallaerrelavevgkakllshrpvrdidrerdllerlitlgka
hhldahyitrlfqliiedsvltqqallqqhlnkin

Timeline for d1ecmb_:

• d1ecmb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ecmb_ appears in SCOPe 2.07