Lineage for d4a05a_ (4a05 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850483Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2850484Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 proteins)
    Pfam PF01341
  6. 2850528Protein automated matches [191253] (6 species)
    not a true protein
  7. 2850532Species Chaetomium thermophilum [TaxId:209285] [194920] (1 PDB entry)
  8. 2850533Domain d4a05a_: 4a05 A: [194921]
    automated match to d1oc7a_
    complexed with li

Details for d4a05a_

PDB Entry: 4a05 (more details), 1.9 Å

PDB Description: structure of the catalytic core domain of the cellobiohydrolase, cel6a, from chaetomium thermophilum
PDB Compounds: (A:) cellobiohydrolase family 6

SCOPe Domain Sequences for d4a05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a05a_ c.6.1.1 (A:) automated matches {Chaetomium thermophilum [TaxId: 209285]}
yngnpfsgvqlwantyyssevhtlaipslspelaakaakvaevpsfqwldrnvtvdtlfs
gtlaeiraanqrganppyagifvvydlpdrdcaaaasngewsianngannykryidrire
lliqysdirtilviepdslanmvtnmnvqkcsnaastykeltvyalkqlnlphvamymda
ghagwlgwpaniqpaaelfaqiyrdagrpaavrglatnvanynawsiasppsytspnpny
dekhyieafapllrnqgfdakfivdtgrngkqptgqlewghwcnvkgtgfgvrptantgh
elvdafvwvkpggesdgtsdtsaarydyhcglsdaltpapeagqwfqayfeqllinanpp

SCOPe Domain Coordinates for d4a05a_:

Click to download the PDB-style file with coordinates for d4a05a_.
(The format of our PDB-style files is described here.)

Timeline for d4a05a_: