![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (32 species) not a true protein |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [194915] (2 PDB entries) |
![]() | Domain d4ag9a_: 4ag9 A: [194917] automated match to d1i21a_ complexed with 16g, coa, edo |
PDB Entry: 4ag9 (more details), 1.76 Å
SCOPe Domain Sequences for d4ag9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ag9a_ d.108.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} shifdasvlaphipsnlpdnfkvrplakddfskgyvdllsqltsvgnldqeafekrfeam rtsvpnyhivviedsnsqkvvasaslvvemkfihgagsrgrvedvvvdtemrrqklgavl lktlvslgkslgvykislecvpellpfysqfgfqddcnfmtqrf
Timeline for d4ag9a_: