Lineage for d4ag9a_ (4ag9 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921812Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1921813Protein automated matches [190038] (32 species)
    not a true protein
  7. 1921924Species Nematode (Caenorhabditis elegans) [TaxId:6239] [194915] (2 PDB entries)
  8. 1921927Domain d4ag9a_: 4ag9 A: [194917]
    automated match to d1i21a_
    complexed with 16g, coa, edo

Details for d4ag9a_

PDB Entry: 4ag9 (more details), 1.76 Å

PDB Description: c. elegans glucosamine-6-phosphate n-acetyltransferase (gna1): ternary complex with coenzyme a and glcnac
PDB Compounds: (A:) glucosamine-6-phosphate n-acetyltransferase

SCOPe Domain Sequences for d4ag9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ag9a_ d.108.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
shifdasvlaphipsnlpdnfkvrplakddfskgyvdllsqltsvgnldqeafekrfeam
rtsvpnyhivviedsnsqkvvasaslvvemkfihgagsrgrvedvvvdtemrrqklgavl
lktlvslgkslgvykislecvpellpfysqfgfqddcnfmtqrf

SCOPe Domain Coordinates for d4ag9a_:

Click to download the PDB-style file with coordinates for d4ag9a_.
(The format of our PDB-style files is described here.)

Timeline for d4ag9a_: