SCOPe 2.06: Domain d4ag9b_: 4ag9 B:

Lineage for d4ag9b_ (4ag9 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (42 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [194915] (2 PDB entries)

8. Domain d4ag9b_: 4ag9 B: [194916]
   automated match to d1i21a_
   complexed with 16g, coa, edo

Details for d4ag9b_

PDB Entry: 4ag9, 1.76 Å

PDB Description: c. elegans glucosamine-6-phosphate n-acetyltransferase (gna1): ternary complex with coenzyme a and glcnac

PDB Compounds: (B:) glucosamine-6-phosphate n-acetyltransferase

SCOPe Domain Sequences for d4ag9b_:

Sequence; same for both SEQRES and ATOM records:

>d4ag9b_ d.108.1.0 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
shifdasvlaphipsnlpdnfkvrplakddfskgyvdllsqltsvgnldqeafekrfeam
rtsvpnyhivviedsnsqkvvasaslvvemkfihgagsrgrvedvvvdtemrrqklgavl
lktlvslgkslgvykislecvpellpfysqfgfqddcnfmtqrf

Timeline for d4ag9b_:

• d4ag9b_ first appeared in SCOPe 2.02
  
• d4ag9b_ appears in SCOPe 2.05
  
• d4ag9b_ appears in SCOPe 2.07
  
• d4ag9b_ appears in the current release, SCOPe 2.08