Lineage for d4ap4b_ (4ap4 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1406947Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1407111Protein automated matches [190124] (12 species)
    not a true protein
  7. 1407121Species Human (Homo sapiens) [TaxId:9606] [186848] (19 PDB entries)
  8. 1407141Domain d4ap4b_: 4ap4 B: [194914]
    Other proteins in same PDB: d4ap4c_, d4ap4f_
    automated match to d2c4pb_
    complexed with zn

Details for d4ap4b_

PDB Entry: 4ap4 (more details), 2.21 Å

PDB Description: rnf4 - ubch5a - ubiquitin heterotrimeric complex
PDB Compounds: (B:) ubiquitin-conjugating enzyme e2 d1

SCOPe Domain Sequences for d4ap4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ap4b_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsgsmalkriqkelsdlqrdppahcragpvgddlfhwqatimgppdsayqggvffltvhf
ptdypfkppkiafttkiyhpninsngsikldilrsqwspaltvskvllsicsllcdpnpd
dplvpdiaqiyksdkekynrharewtqkyam

SCOPe Domain Coordinates for d4ap4b_:

Click to download the PDB-style file with coordinates for d4ap4b_.
(The format of our PDB-style files is described here.)

Timeline for d4ap4b_: