SCOPe 2.06: Domain d4azda1: 4azd A:1-117

Lineage for d4azda1 (4azd A:1-117)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins)

6. Protein automated matches [194905] (2 species)
   not a true protein
7. Species Escherichia coli K-12 [TaxId:83333] [194906] (1 PDB entry)

8. Domain d4azda1: 4azd A:1-117 [194908]
   Other proteins in same PDB: d4azda2
   automated match to d1pqfa_
   complexed with mli; mutant

Details for d4azda1

PDB Entry: 4azd, 1.62 Å

PDB Description: t57v mutant of aspartate decarboxylase

PDB Compounds: (A:) Aspartate 1-decarboxylase

SCOPe Domain Sequences for d4azda1:

Sequence; same for both SEQRES and ATOM records:

>d4azda1 b.52.2.1 (A:1-117) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mirtmlqgklhrvkvthadlhyegscaidqdfldaagileneaidiwnvtngkrfsvyai
aaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemkrt

Timeline for d4azda1:

• d4azda1 first appeared in SCOPe 2.02, called d4azda_
  
• d4azda1 was called d4azda_ in SCOPe 2.05
  
• d4azda1 appears in SCOPe 2.07
  
• d4azda1 appears in the current release, SCOPe 2.08