Class b: All beta proteins [48724] (180 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins) |
Protein automated matches [194905] (2 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [194906] (1 PDB entry) |
Domain d4azdb_: 4azd B: [194907] Other proteins in same PDB: d4azda2 automated match to d1pqfa_ complexed with mli; mutant |
PDB Entry: 4azd (more details), 1.62 Å
SCOPe Domain Sequences for d4azdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4azdb_ b.52.2.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mirtmlqgklhrvkvthadlhyegscaidqdfldaagileneaidiwnvtngkrfsvyai aaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemkrt
Timeline for d4azdb_: