Lineage for d4azdb_ (4azd B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802649Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2802650Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins)
  6. 2802673Protein automated matches [194905] (2 species)
    not a true protein
  7. 2802674Species Escherichia coli K-12 [TaxId:83333] [194906] (1 PDB entry)
  8. 2802676Domain d4azdb_: 4azd B: [194907]
    Other proteins in same PDB: d4azda2
    automated match to d1pqfa_
    complexed with mli; mutant

Details for d4azdb_

PDB Entry: 4azd (more details), 1.62 Å

PDB Description: t57v mutant of aspartate decarboxylase
PDB Compounds: (B:) Aspartate 1-decarboxylase

SCOPe Domain Sequences for d4azdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4azdb_ b.52.2.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mirtmlqgklhrvkvthadlhyegscaidqdfldaagileneaidiwnvtngkrfsvyai
aaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemkrt

SCOPe Domain Coordinates for d4azdb_:

Click to download the PDB-style file with coordinates for d4azdb_.
(The format of our PDB-style files is described here.)

Timeline for d4azdb_: