Lineage for d4fxpc_ (4fxp C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872977Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (8 PDB entries)
  8. 2872984Domain d4fxpc_: 4fxp C: [194901]
    automated match to d3uieb_
    complexed with adx, so4

Details for d4fxpc_

PDB Entry: 4fxp (more details), 1.95 Å

PDB Description: Crystal structure of adenosine 5'-phosphosulfate kinase from Arabidopsis thaliana in Complex with Sulfate and APS
PDB Compounds: (C:) Adenylyl-sulfate kinase 1, chloroplastic

SCOPe Domain Sequences for d4fxpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fxpc_ c.37.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
csvekvdrqrlldqkgcviwvtglsgsgkstlacalnqmlyqkgklcyildgdnvrhgln
rdlsfkaedraenirrvgevaklfadagiiciaslispyrtdrdacrsllpegdfvevfm
dvplsvceardpkglyklaragkikgftgiddpyepplnceislgreggtspiemaekvv
gyldnkgylqa

SCOPe Domain Coordinates for d4fxpc_:

Click to download the PDB-style file with coordinates for d4fxpc_.
(The format of our PDB-style files is described here.)

Timeline for d4fxpc_: