| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.0: automated matches [194891] (1 protein) not a true family |
| Protein automated matches [194892] (2 species) not a true protein |
| Species Oxyuranus scutellatus [TaxId:8667] [194893] (2 PDB entries) |
| Domain d3vbzb_: 3vbz B: [194895] automated match to d2nota_ |
PDB Entry: 3vbz (more details), 1.76 Å
SCOPe Domain Sequences for d3vbzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vbzb_ a.133.1.0 (B:) automated matches {Oxyuranus scutellatus [TaxId: 8667]}
nlvqfgfmiecairnrrpaldfmnygcycgtvgrgtpvddldrccqvhdecyataekhgc
ypslttyqwecrqvgnecnsktqcevfvcacdlaaakclaqedynpahfnintgerck
Timeline for d3vbzb_: