Lineage for d3vbzb_ (3vbz B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2733543Family a.133.1.0: automated matches [194891] (1 protein)
    not a true family
  6. 2733544Protein automated matches [194892] (2 species)
    not a true protein
  7. 2733549Species Oxyuranus scutellatus [TaxId:8667] [194893] (2 PDB entries)
  8. 2733551Domain d3vbzb_: 3vbz B: [194895]
    automated match to d2nota_

Details for d3vbzb_

PDB Entry: 3vbz (more details), 1.76 Å

PDB Description: Crystal structure of Taipoxin beta subunit isoform 2
PDB Compounds: (B:) Phospholipase A2 homolog, taipoxin beta chain

SCOPe Domain Sequences for d3vbzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vbzb_ a.133.1.0 (B:) automated matches {Oxyuranus scutellatus [TaxId: 8667]}
nlvqfgfmiecairnrrpaldfmnygcycgtvgrgtpvddldrccqvhdecyataekhgc
ypslttyqwecrqvgnecnsktqcevfvcacdlaaakclaqedynpahfnintgerck

SCOPe Domain Coordinates for d3vbzb_:

Click to download the PDB-style file with coordinates for d3vbzb_.
(The format of our PDB-style files is described here.)

Timeline for d3vbzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3vbza_