Class a: All alpha proteins [46456] (284 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.0: automated matches [194891] (1 protein) not a true family |
Protein automated matches [194892] (1 species) not a true protein |
Species Oxyuranus scutellatus [TaxId:8667] [194893] (2 PDB entries) |
Domain d3vc0a_: 3vc0 A: [194894] automated match to d2nota_ |
PDB Entry: 3vc0 (more details), 2.15 Å
SCOPe Domain Sequences for d3vc0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vc0a_ a.133.1.0 (A:) automated matches {Oxyuranus scutellatus [TaxId: 8667]} nlvqfgkmiecairnrrpaldfmnygcycgkggsgtpvddldrccqvhdecyaeaekhgc ypslttytwecrqvgpycnsktqcevfvcacdfaaakcfaqedynpahsnintgerck
Timeline for d3vc0a_: