Lineage for d3vc0a_ (3vc0 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2733543Family a.133.1.0: automated matches [194891] (1 protein)
    not a true family
  6. 2733544Protein automated matches [194892] (2 species)
    not a true protein
  7. 2733549Species Oxyuranus scutellatus [TaxId:8667] [194893] (2 PDB entries)
  8. 2733552Domain d3vc0a_: 3vc0 A: [194894]
    automated match to d2nota_

Details for d3vc0a_

PDB Entry: 3vc0 (more details), 2.15 Å

PDB Description: Crystal structure of Taipoxin beta subunit isoform 1
PDB Compounds: (A:) Phospholipase A2 homolog, taipoxin beta chain

SCOPe Domain Sequences for d3vc0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vc0a_ a.133.1.0 (A:) automated matches {Oxyuranus scutellatus [TaxId: 8667]}
nlvqfgkmiecairnrrpaldfmnygcycgkggsgtpvddldrccqvhdecyaeaekhgc
ypslttytwecrqvgpycnsktqcevfvcacdfaaakcfaqedynpahsnintgerck

SCOPe Domain Coordinates for d3vc0a_:

Click to download the PDB-style file with coordinates for d3vc0a_.
(The format of our PDB-style files is described here.)

Timeline for d3vc0a_: