Lineage for d1a6db1 (1a6d B:20-144,B:404-521)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345324Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 2345325Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 2345509Family a.129.1.2: Group II chaperonin (CCT, TRIC), ATPase domain [48596] (1 protein)
  6. 2345510Protein Thermosome, E domain [48597] (3 species)
  7. 2345535Species Thermoplasma acidophilum, beta chain [TaxId:2303] [100917] (2 PDB entries)
  8. 2345536Domain d1a6db1: 1a6d B:20-144,B:404-521 [19489]
    Other proteins in same PDB: d1a6da2, d1a6da3, d1a6db2, d1a6db3

Details for d1a6db1

PDB Entry: 1a6d (more details), 2.6 Å

PDB Description: thermosome from t. acidophilum
PDB Compounds: (B:) thermosome (beta subunit)

SCOPe Domain Sequences for d1a6db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6db1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Thermoplasma acidophilum, beta chain [TaxId: 2303]}
kdamkenieaaiaisnsvrsslgprgmdkmlvdslgdivitndgvtilkemdvehpaakm
mvevsktqdsfvgdgtttaviiaggllqqaqglinqnvhptvisegyrmaseeakrvide
istkiXayaagggataaeiafrlrsyaqkiggrqqlaiekfadaieeipralaenagldp
idillklraehakgnktyginvftgeiedmvkngviepirvgkqaiesateaaimilrid
dvia

SCOPe Domain Coordinates for d1a6db1:

Click to download the PDB-style file with coordinates for d1a6db1.
(The format of our PDB-style files is described here.)

Timeline for d1a6db1: