SCOPe 2.04: Domain d4aiwa_: 4aiw A:

Lineage for d4aiwa_ (4aiw A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.111: PR-1-like [55796] (1 superfamily)
   alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342

4. Superfamily d.111.1: PR-1-like [55797] (2 families)

5. Family d.111.1.1: PR-1-like [55798] (5 proteins)
   Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1

6. Protein automated matches [194852] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [194887] (1 PDB entry)

8. Domain d4aiwa_: 4aiw A: [194888]
   automated match to d1smba_
   complexed with i6p

Details for d4aiwa_

PDB Entry: 4aiw, 1.5 Å

PDB Description: gapr-1 with bound inositol hexakisphosphate

PDB Compounds: (A:) golgi-associated plant pathogenesis-related protein 1

SCOPe Domain Sequences for d4aiwa_:

Sequence; same for both SEQRES and ATOM records:

>d4aiwa_ d.111.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saskqfhnevlkahneyrqkhgvpplklcknlnreaqqysealastrilkhspessrgqc
genlawasydqtgkevadrwyseiknynfqqpgftsgtghftamvwkntkkmgvgkasas
dgssfvvaryfpagnvvnegffeenvlppkk

Timeline for d4aiwa_:

• d4aiwa_ first appeared in SCOPe 2.02
  
• d4aiwa_ appears in SCOPe 2.03
  
• d4aiwa_ appears in SCOPe 2.05
  
• d4aiwa_ appears in the current release, SCOPe 2.08