Lineage for d4aiwa_ (4aiw A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1666044Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 1666045Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 1666046Family d.111.1.1: PR-1-like [55798] (5 proteins)
    Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1
  6. 1666059Protein automated matches [194852] (3 species)
    not a true protein
  7. 1666072Species Human (Homo sapiens) [TaxId:9606] [194887] (1 PDB entry)
  8. 1666073Domain d4aiwa_: 4aiw A: [194888]
    automated match to d1smba_
    complexed with i6p

Details for d4aiwa_

PDB Entry: 4aiw (more details), 1.5 Å

PDB Description: gapr-1 with bound inositol hexakisphosphate
PDB Compounds: (A:) golgi-associated plant pathogenesis-related protein 1

SCOPe Domain Sequences for d4aiwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aiwa_ d.111.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saskqfhnevlkahneyrqkhgvpplklcknlnreaqqysealastrilkhspessrgqc
genlawasydqtgkevadrwyseiknynfqqpgftsgtghftamvwkntkkmgvgkasas
dgssfvvaryfpagnvvnegffeenvlppkk

SCOPe Domain Coordinates for d4aiwa_:

Click to download the PDB-style file with coordinates for d4aiwa_.
(The format of our PDB-style files is described here.)

Timeline for d4aiwa_: