![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
![]() | Protein Trypsin(ogen) [50515] (9 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries) Uniprot P00760 |
![]() | Domain d4b1ta_: 4b1t A: [194884] Other proteins in same PDB: d4b1tb_ automated match to d1v2nt_ complexed with ca, edo, gol |
PDB Entry: 4b1t (more details), 1.78 Å
SCOPe Domain Sequences for d4b1ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b1ta_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdaggp vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
Timeline for d4b1ta_: