Lineage for d4b1ta_ (4b1t A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795997Protein Trypsin(ogen) [50515] (9 species)
  7. 2796015Species Cow (Bos taurus) [TaxId:9913] [50516] (500 PDB entries)
    Uniprot P00760
  8. 2796453Domain d4b1ta_: 4b1t A: [194884]
    Other proteins in same PDB: d4b1tb_, d4b1td_
    automated match to d1v2nt_
    complexed with ca, edo, gol

Details for d4b1ta_

PDB Entry: 4b1t (more details), 1.78 Å

PDB Description: structure of the factor xa-like trypsin variant triple-ala (ta) in complex with eglin c
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d4b1ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b1ta_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdaggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d4b1ta_:

Click to download the PDB-style file with coordinates for d4b1ta_.
(The format of our PDB-style files is described here.)

Timeline for d4b1ta_: