SCOPe 2.08: Domain d4b2ca_: 4b2c A:

Lineage for d4b2ca_ (4b2c A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (500 PDB entries)
   Uniprot P00760

8. Domain d4b2ca_: 4b2c A: [194882]
   Other proteins in same PDB: d4b2cb1, d4b2cb2, d4b2cd1, d4b2cd2
   automated match to d3plba_
   complexed with ca, cl, edo, gol

Details for d4b2ca_

PDB Entry: 4b2c, 1.43 Å

PDB Description: structure of the factor xa-like trypsin variant triple-ala (tpa) in complex with eglin c

PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d4b2ca_:

Sequence; same for both SEQRES and ATOM records:

>d4b2ca_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdaggp
vvcsgklqgivswgsgcaqknkpgfytkvcnyvswikqtiasn

Timeline for d4b2ca_:

• d4b2ca_ first appeared in SCOPe 2.02
  
• d4b2ca_ appears in SCOPe 2.07