![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Trypsin(ogen) [50515] (9 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50516] (500 PDB entries) Uniprot P00760 |
![]() | Domain d4b2ac_: 4b2a C: [194880] Other proteins in same PDB: d4b2ab_, d4b2ad_ automated match to d1v2lt_ complexed with ca, edo, gol |
PDB Entry: 4b2a (more details), 1.89 Å
SCOPe Domain Sequences for d4b2ac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b2ac_ b.47.1.2 (C:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdaggp vvcsgklqgivswgegcaqknkpgvytkvcnyvswikqtiasn
Timeline for d4b2ac_: