Lineage for d1a6da1 (1a6d A:17-145,A:404-519)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6607Fold a.129: GroEL-like chaperones, ATPase domain [48591] (1 superfamily)
  4. 6608Superfamily a.129.1: GroEL-like chaperones, ATPase domain [48592] (2 families) (S)
  5. 6648Family a.129.1.2: Group II chaperonin (CCT, TRIC) [48596] (1 protein)
  6. 6649Protein Thermosome [48597] (1 species)
  7. 6650Species Thermoplasma acidophilum [TaxId:2303] [48598] (2 PDB entries)
  8. 6651Domain d1a6da1: 1a6d A:17-145,A:404-519 [19488]
    Other proteins in same PDB: d1a6da2, d1a6da3, d1a6db2, d1a6db3

Details for d1a6da1

PDB Entry: 1a6d (more details), 2.6 Å

PDB Description: thermosome from t. acidophilum

SCOP Domain Sequences for d1a6da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6da1 a.129.1.2 (A:17-145,A:404-519) Thermosome {Thermoplasma acidophilum}
reqgknaqrnnieaakaiadavrttlgpkgmdkmlvdsigdiiisndgatilkemdvehp
takmivevskaqdtavgdgtttavvlsgellkqaetlldqgvhptvisngyrlavneark
iideiaeksXflwgggaveaelamrlakyansvggreqlaieafakaleiiprtlaenag
idpintliklkaddekgrisvgvdldnngvgdmkakgvvdplrvkthalesavevatmil
riddvi

SCOP Domain Coordinates for d1a6da1:

Click to download the PDB-style file with coordinates for d1a6da1.
(The format of our PDB-style files is described here.)

Timeline for d1a6da1: