Lineage for d4g4fa_ (4g4f A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779160Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1779161Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1779162Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1779263Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (4 species)
  7. 1779291Species Otolemur garnettii [TaxId:30611] [194874] (1 PDB entry)
  8. 1779292Domain d4g4fa_: 4g4f A: [194875]
    automated match to d2r30a1

Details for d4g4fa_

PDB Entry: 4g4f (more details), 1.85 Å

PDB Description: Crystal structure of GITRL from Bushbaby
PDB Compounds: (A:) Tumor necrosis factor ligand superfamily member 18

SCOPe Domain Sequences for d4g4fa_:

Sequence, based on SEQRES records: (download)

>d4g4fa_ b.22.1.1 (A:) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Otolemur garnettii [TaxId: 30611]}
kpclakfelltskwqmtsrkppcvnslpegklkilqdglyliygqvapstaykgvapfav
qlrkneamlqtltsnstiydvggtyefhagdiidlifddehqvlknntywgivllanlfi
s

Sequence, based on observed residues (ATOM records): (download)

>d4g4fa_ b.22.1.1 (A:) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Otolemur garnettii [TaxId: 30611]}
kpclakfelltskwqmtsrkppcvnslpegklkilqdglyliygqvapspfavqlrknea
mlqtltsnstiydvggtyefhagdiidlifddehqvlknntywgivllanlfis

SCOPe Domain Coordinates for d4g4fa_:

Click to download the PDB-style file with coordinates for d4g4fa_.
(The format of our PDB-style files is described here.)

Timeline for d4g4fa_: