SCOPe 2.06: Domain d3t0ra_: 3t0r A:

Lineage for d3t0ra_ (3t0r A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (26 species)
   not a true protein

7. Species Bothrops moojeni [TaxId:98334] [188126] (4 PDB entries)

8. Domain d3t0ra_: 3t0r A: [194872]
   automated match to d2q2ja_
   complexed with pe4

Details for d3t0ra_

PDB Entry: 3t0r, 2.49 Å

PDB Description: crystal structure of mjtx-i, a myotoxic lys49-phospholipase a2 from bothrops moojeni

PDB Compounds: (A:) Phospholipase A2 homolog 1

SCOPe Domain Sequences for d3t0ra_:

Sequence; same for both SEQRES and ATOM records:

>d3t0ra_ a.133.1.2 (A:) automated matches {Bothrops moojeni [TaxId: 98334]}
slvelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltncdpk
kdrysydwknktivcgeenpclkqlcecdkavaiclrenkgtynkkrdvylkpfcdkgrd
c

Timeline for d3t0ra_:

• d3t0ra_ first appeared in SCOPe 2.02
  
• d3t0ra_ appears in SCOPe 2.05
  
• d3t0ra_ appears in SCOPe 2.07
  
• d3t0ra_ appears in the current release, SCOPe 2.08