| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
| Protein automated matches [190139] (27 species) not a true protein |
| Species Bothrops moojeni [TaxId:98334] [188126] (13 PDB entries) |
| Domain d3t0rb_: 3t0r B: [194871] automated match to d2q2ja_ complexed with pe4 |
PDB Entry: 3t0r (more details), 2.49 Å
SCOPe Domain Sequences for d3t0rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t0rb_ a.133.1.2 (B:) automated matches {Bothrops moojeni [TaxId: 98334]}
slvelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltncdpk
kdrysydwknktivcgeenpclkqlcecdkavaiclrenkgtynkkrdvylkpfcdkgrd
c
Timeline for d3t0rb_: