Lineage for d3t0rc_ (3t0r C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733318Species Bothrops moojeni [TaxId:98334] [188126] (13 PDB entries)
  8. 2733347Domain d3t0rc_: 3t0r C: [194870]
    automated match to d2q2ja_
    complexed with pe4

Details for d3t0rc_

PDB Entry: 3t0r (more details), 2.49 Å

PDB Description: crystal structure of mjtx-i, a myotoxic lys49-phospholipase a2 from bothrops moojeni
PDB Compounds: (C:) Phospholipase A2 homolog 1

SCOPe Domain Sequences for d3t0rc_:

Sequence, based on SEQRES records: (download)

>d3t0rc_ a.133.1.2 (C:) automated matches {Bothrops moojeni [TaxId: 98334]}
slvelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltncdpk
kdrysydwknktivcgeenpclkqlcecdkavaiclrenkgtynkkrdvylkpfcdkgrd
c

Sequence, based on observed residues (ATOM records): (download)

>d3t0rc_ a.133.1.2 (C:) automated matches {Bothrops moojeni [TaxId: 98334]}
slvelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltncdpk
kdrysydwknktivcgeenpclkqlcecdkavaiclrenkgtynkkrdpfcdkgrdc

SCOPe Domain Coordinates for d3t0rc_:

Click to download the PDB-style file with coordinates for d3t0rc_.
(The format of our PDB-style files is described here.)

Timeline for d3t0rc_: