Lineage for d1grl_1 (1grl 6-136,410-523)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51151Fold a.129: GroEL-like chaperones, ATPase domain [48591] (1 superfamily)
  4. 51152Superfamily a.129.1: GroEL-like chaperones, ATPase domain [48592] (2 families) (S)
  5. 51153Family a.129.1.1: GroEL [48593] (1 protein)
  6. 51154Protein GroEL [48594] (1 species)
  7. 51155Species Escherichia coli [TaxId:562] [48595] (4 PDB entries)
  8. 51191Domain d1grl_1: 1grl 6-136,410-523 [19487]
    Other proteins in same PDB: d1grl_2, d1grl_3

Details for d1grl_1

PDB Entry: 1grl (more details), 2.8 Å

PDB Description: the crystal structure of the bacterial chaperonin groel at 2.8 angstroms

SCOP Domain Sequences for d1grl_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grl_1 a.129.1.1 (6-136,410-523) GroEL {Escherichia coli}
vkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareieledk
fenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgidkavt
vaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrqivln
cgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvaglmitt
ecmvtd

SCOP Domain Coordinates for d1grl_1:

Click to download the PDB-style file with coordinates for d1grl_1.
(The format of our PDB-style files is described here.)

Timeline for d1grl_1: