Lineage for d3t63o_ (3t63 O:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2042612Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2042613Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2042822Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 2042837Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries)
  8. 2042843Domain d3t63o_: 3t63 O: [194868]
    Other proteins in same PDB: d3t63a_, d3t63b_, d3t63c_
    automated match to d3mi1m_
    complexed with bme, fe, gol, so4; mutant

Details for d3t63o_

PDB Entry: 3t63 (more details), 1.54 Å

PDB Description: axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase
PDB Compounds: (O:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d3t63o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t63o_ b.3.6.1 (O:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpapwrngpndwrpahiyfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc

SCOPe Domain Coordinates for d3t63o_:

Click to download the PDB-style file with coordinates for d3t63o_.
(The format of our PDB-style files is described here.)

Timeline for d3t63o_: