| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
| Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
| Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species) |
| Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries) |
| Domain d3t63m_: 3t63 M: [194867] Other proteins in same PDB: d3t63a_, d3t63b_, d3t63c_ automated match to d3mi1m_ complexed with bme, fe, gol, so4; mutant |
PDB Entry: 3t63 (more details), 1.54 Å
SCOPe Domain Sequences for d3t63m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t63m_ b.3.6.1 (M:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpapwrngpndwrpahiyfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
Timeline for d3t63m_: