Lineage for d3ur5a_ (3ur5 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096081Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2096195Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 2096196Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (4 species)
  7. 2096230Species Pseudomonas diminuta [TaxId:293] [51566] (23 PDB entries)
    Uniprot P0A434 30-365
  8. 2096246Domain d3ur5a_: 3ur5 A: [194858]
    automated match to d3caka_
    complexed with co, dpf; mutant

Details for d3ur5a_

PDB Entry: 3ur5 (more details), 1.6 Å

PDB Description: crystal structure of pte mutant k185r/i274n
PDB Compounds: (A:) Parathion hydrolase

SCOPe Domain Sequences for d3ur5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ur5a_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]}
drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkatpfqelvlraaaraslatgvpvtthtaasqrdgeqqaa
ifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallgn
rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvip
flrekgvpqetlagitvtnparflspt

SCOPe Domain Coordinates for d3ur5a_:

Click to download the PDB-style file with coordinates for d3ur5a_.
(The format of our PDB-style files is described here.)

Timeline for d3ur5a_: