SCOPe 2.08: Domain d3uraa_: 3ura A:

Lineage for d3uraa_ (3ura A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
   automatically mapped to Pfam PF02126

6. Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (5 species)

7. Species Brevundimonas diminuta [TaxId:293] [193602] (6 PDB entries)

8. Domain d3uraa_: 3ura A: [194855]
   automated match to d1p6cb_
   complexed with co, imd; mutant

Details for d3uraa_

PDB Entry: 3ura, 1.88 Å

PDB Description: crystal structure of pte mutant h254g/h257w/l303t/k185r/i274n/a80v/s61t

PDB Compounds: (A:) Parathion hydrolase

SCOPe Domain Sequences for d3uraa_:

Sequence; same for both SEQRES and ATOM records:

>d3uraa_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Brevundimonas diminuta [TaxId: 293]}
drintvrgpitiseagftlthehicgtsagflrawpeffgsrkalvekavrglrraraag
vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkatpfqelvlraaaraslatgvpvtthtaasqrdgeqqaa
ifeseglspsrvcighsddtddlsyltalaargyligldgipwsaiglednasasallgn
rswqtrallikalidqgymkqilvsndwtfgfssyvtnimdvmdrvnpdgmafiplrvip
flrekgvpqetlagitvtnparflspt

Timeline for d3uraa_:

• d3uraa_ first appeared in SCOPe 2.02
  
• d3uraa_ appears in SCOPe 2.07