SCOPe 2.08: Domain d4alob_: 4alo B:

Lineage for d4alob_ (4alo B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (13 species)
   not a true protein

7. Species American lobster (Homarus americanus) [TaxId:6706] [194849] (1 PDB entry)

8. Domain d4alob_: 4alo B: [194850]
   automated match to d1i4ua_
   complexed with mpd, na, so4

Details for d4alob_

PDB Entry: 4alo, 2.37 Å

PDB Description: structure and properties of h1 crustacyanin from lobster homarus americanus

PDB Compounds: (B:) h1 apocrustacyanin

SCOPe Domain Sequences for d4alob_:

Sequence; same for both SEQRES and ATOM records:

>d4alob_ b.60.1.1 (B:) automated matches {American lobster (Homarus americanus) [TaxId: 6706]}
dkipdfvvpgkcasvtrnklwaeqtpnrnmyagvwyqfaltnnpyqliekcvrneysfdg
eqfvitstgiaydgnllkrngklypnpfgephlsidyemsfaaplviletdysnyaclys
cidynfgyhsdfsfifsrsanladkyvkkceaafkninvdttrfvktvqgsscpydtqkt
v

Timeline for d4alob_:

• d4alob_ first appeared in SCOPe 2.02
  
• d4alob_ appears in SCOPe 2.07