Lineage for d1aonm1 (1aon M:2-136,M:410-525)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6607Fold a.129: GroEL-like chaperones, ATPase domain [48591] (1 superfamily)
  4. 6608Superfamily a.129.1: GroEL-like chaperones, ATPase domain [48592] (2 families) (S)
  5. 6609Family a.129.1.1: GroEL [48593] (1 protein)
  6. 6610Protein GroEL [48594] (1 species)
  7. 6611Species Escherichia coli [TaxId:562] [48595] (4 PDB entries)
  8. 6645Domain d1aonm1: 1aon M:2-136,M:410-525 [19485]
    Other proteins in same PDB: d1aona2, d1aona3, d1aonb2, d1aonb3, d1aonc2, d1aonc3, d1aond2, d1aond3, d1aone2, d1aone3, d1aonf2, d1aonf3, d1aong2, d1aong3, d1aonh2, d1aonh3, d1aoni2, d1aoni3, d1aonj2, d1aonj3, d1aonk2, d1aonk3, d1aonl2, d1aonl3, d1aonm2, d1aonm3, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_

Details for d1aonm1

PDB Entry: 1aon (more details), 3 Å

PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7

SCOP Domain Sequences for d1aonm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aonm1 a.129.1.1 (M:2-136,M:410-525) GroEL {Escherichia coli}
aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtaaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

SCOP Domain Coordinates for d1aonm1:

Click to download the PDB-style file with coordinates for d1aonm1.
(The format of our PDB-style files is described here.)

Timeline for d1aonm1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aona1, d1aona2, d1aona3, d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonk1, d1aonk2, d1aonk3, d1aonl1, d1aonl2, d1aonl3, d1aonn1, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_