Class g: Small proteins [56992] (100 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins) |
Protein automated matches [194842] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [194843] (2 PDB entries) |
Domain d4ay9d_: 4ay9 D: [194847] automated match to d1dz7a_ complexed with nag |
PDB Entry: 4ay9 (more details), 2.5 Å
SCOPe Domain Sequences for d4ay9d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ay9d_ g.17.1.4 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vqdcpectlqenplfsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccvak synrvtvmggfkvenhtachcstcyyhks
Timeline for d4ay9d_: