SCOPe 2.05: Domain d4aocb_: 4aoc B:

Lineage for d4aocb_ (4aoc B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key

4. Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families)

5. Family b.115.1.0: automated matches [191398] (1 protein)
   not a true family

6. Protein automated matches [190521] (2 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [188413] (5 PDB entries)

8. Domain d4aocb_: 4aoc B: [194821]
   automated match to d2vnvb_
   complexed with a1q, ca, so4

Details for d4aocb_

PDB Entry: 4aoc, 2.7 Å

PDB Description: crystal structure of bc2l-a lectin from burkolderia cenocepacia in complex with methyl-heptoside

PDB Compounds: (B:) bc2l-a lectin

SCOPe Domain Sequences for d4aocb_:

Sequence; same for both SEQRES and ATOM records:

>d4aocb_ b.115.1.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
ragefsippntdfraiffanaaeqqhiklfigdsqepaayhklttrdgpreatlnsgngk
irfevsvngkpsatdarlapingkksdgspftvnfgivvsedghdsdyndgivvlqwpig

Timeline for d4aocb_:

• d4aocb_ first appeared in SCOPe 2.02
  
• d4aocb_ appears in SCOPe 2.04
  
• d4aocb_ appears in SCOPe 2.06
  
• d4aocb_ appears in the current release, SCOPe 2.08