SCOPe 2.04: Domain d4auqa_: 4auq A:

Lineage for d4auqa_ (4auq A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (29 PDB entries)

8. Domain d4auqa_: 4auq A: [194819]
   Other proteins in same PDB: d4auqc_, d4auqf_
   automated match to d3a33a_
   complexed with zn

Details for d4auqa_

PDB Entry: 4auq, 2.18 Å

PDB Description: structure of birc7-ubch5b-ub complex.

PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d4auqa_:

Sequence; same for both SEQRES and ATOM records:

>d4auqa_ d.20.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alkrihkelndlardppaqcragpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpainsngsisldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

Timeline for d4auqa_:

• d4auqa_ first appeared in SCOPe 2.02
  
• d4auqa_ appears in SCOPe 2.03
  
• d4auqa_ appears in SCOPe 2.05
  
• d4auqa_ appears in the current release, SCOPe 2.08