SCOPe 2.08: Domain d4auqd_: 4auq D:

Lineage for d4auqd_ (4auq D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries)

8. Domain d4auqd_: 4auq D: [194817]
   Other proteins in same PDB: d4auqc1, d4auqc2, d4auqf_
   automated match to d3a33a_
   complexed with zn

Details for d4auqd_

PDB Entry: 4auq, 2.18 Å

PDB Description: structure of birc7-ubch5b-ub complex.

PDB Compounds: (D:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d4auqd_:

Sequence; same for both SEQRES and ATOM records:

>d4auqd_ d.20.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alkrihkelndlardppaqcragpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpainsngsisldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

Timeline for d4auqd_:

• d4auqd_ first appeared in SCOPe 2.02
  
• d4auqd_ appears in SCOPe 2.07