Lineage for d4dygb_ (4dyg B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924182Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
    automatically mapped to Pfam PF00182
  6. 2924190Protein automated matches [190455] (7 species)
    not a true protein
  7. 2924211Species Secale cereale [TaxId:4550] [194813] (3 PDB entries)
  8. 2924215Domain d4dygb_: 4dyg B: [194814]
    automated match to d2baaa_
    complexed with mes, so4, zn

Details for d4dygb_

PDB Entry: 4dyg (more details), 1.7 Å

PDB Description: crystal structure of a family gh-19 chitinase from rye seeds in complex with (glcnac)4
PDB Compounds: (B:) Basic endochitinase C

SCOPe Domain Sequences for d4dygb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dygb_ d.2.1.1 (B:) automated matches {Secale cereale [TaxId: 4550]}
svssiishaqfdrmllhrndgacqakgfytydafvaaanafpgfgatgstdarkrdvaaf
laqtshettggwatapdgafawgycfkqergaaadyctpsaqwpcapgkryygrgpiqls
hnynygpagraigvdllrnpdlvatdptvsfktalwfwmtaqapkpsshavitgkwspsg
adraagrapgfgvitniingglecghgqdsrvadrigfykrycdilgvgygdnldcynqr
pf

SCOPe Domain Coordinates for d4dygb_:

Click to download the PDB-style file with coordinates for d4dygb_.
(The format of our PDB-style files is described here.)

Timeline for d4dygb_: