Lineage for d4g5da_ (4g5d A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829673Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2829674Protein automated matches [190793] (31 species)
    not a true protein
  7. 2829756Species Leishmania major [TaxId:347515] [194809] (2 PDB entries)
  8. 2829759Domain d4g5da_: 4g5d A: [194810]
    automated match to d1vbjb_
    complexed with ndp

Details for d4g5da_

PDB Entry: 4g5d (more details), 1.8 Å

PDB Description: x-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to nadph
PDB Compounds: (A:) Prostaglandin f2-alpha synthase/D-arabinose dehydrogenase

SCOPe Domain Sequences for d4g5da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g5da_ c.1.7.0 (A:) automated matches {Leishmania major [TaxId: 347515]}
agvdkamvtlsngvkmpqfglgvwqspagevtenavkwalcagyrhidtaaiykneesvg
aglrasgvpredvfittklwnteqgyestlaafeesrqklgvdyidlylihwprgkdils
kegkkyldswrafeqlykekkvraigvsnfhihhledvlamctvtpmvnqvelhplnnqa
dlrafcdakqikveawsplgqgkllsnpilsaigakynktaaqvilrwniqknlitipks
vhrerieenadifdfelgaedvmsidalntnsrygpdpdeaqf

SCOPe Domain Coordinates for d4g5da_:

Click to download the PDB-style file with coordinates for d4g5da_.
(The format of our PDB-style files is described here.)

Timeline for d4g5da_: