Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (73 species) not a true protein |
Species Salmonella enterica [TaxId:550537] [194806] (1 PDB entry) |
Domain d4g81c_: 4g81 C: [194807] automated match to d3uf0a_ complexed with cl, edo, gol |
PDB Entry: 4g81 (more details), 1.9 Å
SCOPe Domain Sequences for d4g81c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g81c_ c.2.1.0 (C:) automated matches {Salmonella enterica [TaxId: 550537]} alfdltgktalvtgsarglgfayaeglaaagarvilndiratllaesvdtltrkgydahg vafdvtdelaieaafskldaegihvdilinnagiqyrkpmvelelenwqkvidtnltsaf lvsrsaakrmiarnsggkiinigsltsqaarptvapytaakggikmltcsmaaewaqfni qtnaigpgyiltdmntaliedkqfdswvksstpsqrwgrpeeligtaiflsskasdying qiiyvdggwlavl
Timeline for d4g81c_: