![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
![]() | Family c.77.1.0: automated matches [191423] (1 protein) not a true family |
![]() | Protein automated matches [190603] (16 species) not a true protein |
![]() | Species Burkholderia xenovorans [TaxId:266265] [194800] (1 PDB entry) |
![]() | Domain d4atya_: 4aty A: [194801] automated match to d2hi1b_ complexed with bme, zn |
PDB Entry: 4aty (more details), 1.85 Å
SCOPe Domain Sequences for d4atya_:
Sequence, based on SEQRES records: (download)
>d4atya_ c.77.1.0 (A:) automated matches {Burkholderia xenovorans [TaxId: 266265]} ramtvalaigdpngigpeiavkaaaqmardersehgghavhsqprivlfgdafvirryar qccpelmlrlvqlddlpsaepnaidmvdvaslpaeafvpgevaaaagtatlayvsaalra aragqvdaviacphsetainasgvrfagypgfvahemgmpaedvyllliggglrivhatl hegiasalarldqrhveraaraavqalqlmgiahpvvglmginphagegglfgrddidit epvarklrddgmtvigpqgadllltnpdidvfvamyhdqghipvklragrhsaalsigag vlfssvghgsgfdiagtlladpapllgairlvttgtvla
>d4atya_ c.77.1.0 (A:) automated matches {Burkholderia xenovorans [TaxId: 266265]} ramtvalaigdpngigpeiavkaaaqmqpivlfgdafvirryarqcclmlrlvpsaidmv dvaslpaeafvpgevaaaagtatlayvsaalraaragqvdaviacphsetainasgagyp gfvahemgmpaedvyllliggglrivhatlhegiasalarldqrhveraaraavqalqlm giahpvvglmginphagegglfgrddiditepvarklrddgmtvigpqgadllltnpdid vfvamyhdqghipvklragrhsaalsigagvlfssvghgsgfdiagtlladpapllgair lvttgtvla
Timeline for d4atya_: