Lineage for d4atya_ (4aty A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138965Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2138966Protein automated matches [190603] (16 species)
    not a true protein
  7. 2138997Species Burkholderia xenovorans [TaxId:266265] [194800] (1 PDB entry)
  8. 2138998Domain d4atya_: 4aty A: [194801]
    automated match to d2hi1b_
    complexed with bme, zn

Details for d4atya_

PDB Entry: 4aty (more details), 1.85 Å

PDB Description: crystal structure of a terephthalate 1,2-cis- dihydrodioldehydrogenase from burkholderia xenovorans lb400
PDB Compounds: (A:) terephthalate 1,2-cis-dihydrodiol dehydrogenase

SCOPe Domain Sequences for d4atya_:

Sequence, based on SEQRES records: (download)

>d4atya_ c.77.1.0 (A:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ramtvalaigdpngigpeiavkaaaqmardersehgghavhsqprivlfgdafvirryar
qccpelmlrlvqlddlpsaepnaidmvdvaslpaeafvpgevaaaagtatlayvsaalra
aragqvdaviacphsetainasgvrfagypgfvahemgmpaedvyllliggglrivhatl
hegiasalarldqrhveraaraavqalqlmgiahpvvglmginphagegglfgrddidit
epvarklrddgmtvigpqgadllltnpdidvfvamyhdqghipvklragrhsaalsigag
vlfssvghgsgfdiagtlladpapllgairlvttgtvla

Sequence, based on observed residues (ATOM records): (download)

>d4atya_ c.77.1.0 (A:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ramtvalaigdpngigpeiavkaaaqmqpivlfgdafvirryarqcclmlrlvpsaidmv
dvaslpaeafvpgevaaaagtatlayvsaalraaragqvdaviacphsetainasgagyp
gfvahemgmpaedvyllliggglrivhatlhegiasalarldqrhveraaraavqalqlm
giahpvvglmginphagegglfgrddiditepvarklrddgmtvigpqgadllltnpdid
vfvamyhdqghipvklragrhsaalsigagvlfssvghgsgfdiagtlladpapllgair
lvttgtvla

SCOPe Domain Coordinates for d4atya_:

Click to download the PDB-style file with coordinates for d4atya_.
(The format of our PDB-style files is described here.)

Timeline for d4atya_: